PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000123467
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 63aa    MW: 7418.46 Da    PI: 8.0752
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000123467genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY604.5e-193422059
                   S-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY 20 fprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                     rsYYrCt++gC+vkk+v+r ++d+ +v++tYeg H+h+
  MDP0000123467  3 ACRSYYRCTYQGCNVKKQVQRLNKDEGIVVTTYEGMHTHP 42
                   68*************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081117.327144IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.1E-17242IPR003657WRKY domain
SMARTSM007746.5E-11243IPR003657WRKY domain
SuperFamilySSF1182904.84E-16343IPR003657WRKY domain
PfamPF031062.0E-14342IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MPACRSYYRC TYQGCNVKKQ VQRLNKDEGI VVTTYEGMHT HPIDKPSDNF EHILSQMQIY  60
THI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008379098.11e-37PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA23e-28WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLM5WY441e-33M5WY44_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s33560.14e-33(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-29WRKY DNA-binding protein 75